DPCstruct | MC27480
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 204 ± 14 aa |
| Standard deviation of domain lengths | 13.60 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 66.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 44.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z7CQT8 | 1-216 | MSIEDIFMSIPAEVRLPSTGVEITKITIGKEIKIPGVNEKACFLATLPQIPADDKGKKLLIEKDPVKGNPVEEQVVLVKAVIELLVE… |
| A0A2Z7B082 | 118-296 | NSGEQERIEVDQIVHGGGDECFEGVLEFDAQKEHEGQKDPEITAAEREVSHYDPIPVEECFQLLIKSAWDNVSTRMTIFEEWLHFHK… |
| A0A2Z7DCN2 | 87-280 | None |
| A0A2Z7DD49 | 326-540 | None |
| A0A2Z7C9V1 | 391-582 | None |
| A0A2Z7CSZ5 | 30-245 | None |
| A0A2Z7AAC3 | 328-543 | None |
| A0A2Z7AZ01 | 222-415 | None |
| A0A2Z7BVT5 | 149-364 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.