DPCstruct | MC2748
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 67 ± 7 aa |
| Standard deviation of domain lengths | 6.75 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 41.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M9XU44 | 1-57 | MLLHASTRYAAYGRDLEYMWHWEILRDDEFVQEGCSLSERSAREAVALVVRFFERQD |
| A0A512E1T7 | 1-71 | MDTSADRESIEIFRNERFEAYAQDLGFMWRWEIHSDGKLMQEGCSLTKRAADEAVGYVVAYFGRIRGVGPD |
| Q3YA77 | 3-66 | None |
| A0A6B8KIS3 | 23-84 | None |
| A0A2N2VKK5 | 11-83 | None |
| A0A8B6M8C6 | 1-67 | None |
| P22867 | 26-93 | None |
| A0A2N8LF93 | 4-61 | None |
| A0A1R4HAH5 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.