DPCstruct | MC27474
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 316 ± 25 aa |
| Standard deviation of domain lengths | 24.91 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 37.22 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0126- CL0066 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N0ZLR1 | 303-617 | SRGSFNGPGGPHTRWMVMPTLGASSPSHHMLRNKIKQGFLAEEEYINVDRDELADTGPVFADILAREIPVSSEFGRENVFAGINIEM… |
| A0A7C0VQ10 | 1-331 | MLRNRMAIDFISENDVLTLSRDGLAETGLVVADITARAVEPLVGSYAGLIVRLDGEEPHDRTPPFDPAVDPLSPGIPAYNFYSMEVV… |
| H0EJZ6 | 181-496 | None |
| A0A0L6JVV8 | 254-626 | None |
| A0A061NKE9 | 31-308 | None |
| A0A066X5L8 | 475-795 | None |
| A0A0G4LGP9 | 228-525 | None |
| A0A810M2N0 | 1-253 | None |
| A0A2T2P0I4 | 38-358 | None |
| A0A1D2JDB6 | 342-663 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.