DPCstruct | MC27470
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 190 ± 19 aa |
| Standard deviation of domain lengths | 18.86 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P0SIE0 | 1-154 | MLWPFLTRFFVTIGLLQNKIFINTTSAERAALLLQYLVDNSTEIPEHILPLHKILCGIYLLEPIDTNLEITEQERAECEKLLSAVIQ… |
| A0A6N6KLB2 | 28-233 | STMDLKLTKLTDLEDSVNSEGWIEKDLTDNLENQQTSEDEDEAIFVPFAGIVLMAVFLKPLFDELGLIEKGAFKSFKHQEKAIHILY… |
| A0A5S3XI77 | 1088-1274 | None |
| A0A0W0JHZ2 | 669-877 | None |
| A0A330ENA4 | 125-318 | None |
| A0A1R3VK55 | 171-345 | None |
| A0A3S0R9A0 | 392-607 | None |
| A0A7X7BE70 | 2-128 | None |
| A0A366BY75 | 856-1050 | None |
| A0A1M7DVF8 | 152-353 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.