DPCstruct | MC2747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 151 ± 13 aa |
| Standard deviation of domain lengths | 12.69 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 27.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A4QRT0 | 1-145 | MLKKFFILCILATAAIFSSTTILIVFGMMPTLACFAIDKTIGKSKTICVGFMNFAGCFPFLLDFWTKFGQQNMENALSMIADIENML… |
| A0A512DT53 | 2-139 | VTVLLILMPVGLIFLPTTVLLAVGMIPTVVAYVVDRDPDKTAPMTVGGLNFAGVFAFAVSLWQAGHTMAALSRILTDPFAWLVMYGA… |
| A0A7Y0DWZ8 | 21-180 | None |
| A0A3M0ZXI4 | 15-167 | None |
| A0A2A4YYZ8 | 13-161 | None |
| A0A3M0CTU2 | 43-198 | None |
| A0A2E7V375 | 13-163 | None |
| A0A2E1CSA8 | 39-190 | None |
| A0A2E7RBT7 | 7-169 | None |
| A0A3D3IUK4 | 2-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.