DPCstruct | MC27469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 504 ± 48 aa |
| Standard deviation of domain lengths | 48.05 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N6KJD8 | 1-551 | MSIYRLSGCSGQEGLLCDAVRKEPFCVLLFDEVEKAHQGFFDLLLQILGEGRMTDGTGKLVNFCSTIILMTSNIGVDVLQRSSVNLV… |
| A0A849YVB0 | 163-632 | EKLIGDPKKGTTGMLTDFVRKSPFGVILLDEFEKGHSNIADLFLQVFDDGRLTDAYGETVGFQHALLLLTSNVGSDISALEHAIGFA… |
| A0A836SGP0 | 48-605 | None |
| A0A660LCM6 | 513-947 | None |
| A0A7C3C9R8 | 1-467 | None |
| A0A7V2RRK8 | 559-1100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.