DPCstruct | MC27467
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 176 ± 33 aa |
| Standard deviation of domain lengths | 32.80 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 54.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J5VHM3 | 2-126 | KLQTEIFFASIDQRSERAAGESACTALVAVIADWFQNNRELMPIKSQFDSLIREGSLEWRNLCENETYRERFPDKHFDLETVLQAKI… |
| A0A6A2X1C8 | 1-171 | MVRLFLWKKRRLSFRSSKKKAQPLVQTGENCWEVKQLVSRNRQAKLKAQVFFASFDQRSERAAGESACTALVAVIAHRLNSNQASMP… |
| A0A2U1MXH5 | 87-293 | None |
| A0A2U1Q5Z2 | 518-732 | None |
| A0A7J6FKV0 | 863-1009 | None |
| A0A7I8IBV2 | 96-274 | None |
| A0A2G2ZG84 | 3-169 | None |
| A0A2Z7BPY7 | 2-126 | None |
| A0A4D9ASB3 | 118-315 | None |
| A0A2G2UZP4 | 8-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.