DPCstruct | MC27464
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 117 ± 13 aa |
| Standard deviation of domain lengths | 12.52 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 70.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 41.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6WUJ5 | 2-132 | VNRIPQGAHLTIIADSCNSGGLIEMLKEQVGPGFPPHVCYTPRAYDYNPLYKPRLMPMTAIVRYLESRSGLNSPDIGRHLRHIYGND… |
| A0A6A2WCM8 | 4-125 | RQLVNRVPEGASFTILSDSCHSGGLIDKEKEQIGPSTYKTTSSSLSYKPKTIPFESILHHLSALTGINSSDIGTHLLESFGANASLK… |
| A0A836EFW4 | 36-150 | None |
| A0A822ZX47 | 14-133 | None |
| A0A6P4Q361 | 8-137 | None |
| A0A6P5G312 | 1-107 | None |
| A0A822YX88 | 4-100 | None |
| A0A022PYI5 | 20-135 | None |
| A0A0D2UIJ7 | 47-179 | None |
| A0A4D9B6A8 | 39-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.