DPCstruct | MC2746
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 119 ± 7 aa |
| Standard deviation of domain lengths | 7.26 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 68.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.77 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 44.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A651DZH9 | 1-118 | MPGFGDLVQKAFYLGVGIASYAGEKAGTTFTELRSQAQKLADEMVARGEMNTEEAKRMVDEMVSKAQQSPKAPTAERPSEPRRIEIL… |
| A0A2N5JSD3 | 3-103 | ILQKVFYFGVGLISLAGEKTTSTLEQLRQQTVKLADELVRRGELTTEEARRFVDEVMDQAKPDRPQPRPIEILENTSEDEEIERLKQ… |
| A0A098TN36 | 2-118 | None |
| A0A846DYK3 | 3-121 | None |
| A0A2W7BZ79 | 3-124 | None |
| A0A2T1C2B1 | 2-120 | None |
| A0A068MZB8 | 6-128 | None |
| A0A372DTC4 | 1-120 | None |
| A0A2G8PAB8 | 1-132 | None |
| A0A6M0CC98 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.