DPCstruct | MC27455
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 116 ± 18 aa |
| Standard deviation of domain lengths | 17.72 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8AYG6 | 1-103 | EVARGTSGEDGFVDFNGGTDELDYGKYTIIETKAPEGYRAITKPIEVEINGDNHQAEVTVNNYKSDWELPKTGGIGTLLYSMIGLTL… |
| A0A2Z6G247 | 24-134 | KSGTNGVFEIKGLVFAKDTNVDGASVKYQLKETKAPEGYVKPSEVVTFNVTKDSYNKSAQEVNIADATPDTINNNKRPSIPNTGGIG… |
| A0A376CKH8 | 2-120 | None |
| A0A7U9QRQ8 | 1-143 | None |
| A0A7X6TN86 | 1-85 | None |
| A0A3A1XZT9 | 4-123 | None |
| A0A7T7ZVT8 | 45-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.