DPCstruct | MC27454
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 141 ± 17 aa |
| Standard deviation of domain lengths | 16.98 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J6HNT0 | 46-182 | MFALFFIFVIGPLLELYVLVSVAGWIGWFPALALLAAMSLFGAWLVKREGLGVMRRMQESAGRGEVPANQVVDGGLLLLAGCLCIVP… |
| A0A7X8AXV6 | 2-122 | LLLLIVPAIEIAIFIWAGGEIGVWSVLGLIVLTAVLGSLIVRHEGLETLRRAQMAMERMEFPAEELLDGILILIGAVLLITPGFFTD… |
| A0A3M1S786 | 2-149 | None |
| A0A6C1PGE7 | 19-152 | None |
| A0A842KAA3 | 2-118 | None |
| A0A7V2AC02 | 136-256 | None |
| A0A353N7D8 | 1-123 | None |
| E3BDQ6 | 13-136 | None |
| F2I2X1 | 4-119 | None |
| A0A7X4YQ66 | 1-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.