DPCstruct | MC27453
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 160 ± 14 aa |
| Standard deviation of domain lengths | 13.59 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C0BU55 | 1-148 | MVLSLLAAFGLFAPGNYARAADPVFCGKYANNADKAVKLAKQLKCGFQGLRWGKGTSGHLAWCLIVDETLAQSEADARASELQDCTC… |
| A0A2S0NFL0 | 3-168 | LLALVTVAALTPLSSTTGFAQQAQFERFCRDYADHAVSAANRAAQAGCAPHRAFRNDFVADRALHYNWCLRAPEQAVAAGRQSRQQA… |
| A0A317T8V9 | 2-180 | None |
| A0A2N3BBD5 | 219-387 | None |
| A0A6M8VUK6 | 7-178 | None |
| A0A6M8VLA0 | 8-181 | None |
| A0A0D2JY11 | 242-388 | None |
| A0A5D0RNM9 | 7-157 | None |
| A0A522UP08 | 12-187 | None |
| A0A559QU73 | 52-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.