DPCstruct | MC27452
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 66 ± 7 aa |
| Standard deviation of domain lengths | 6.62 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 79.86 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF01737- PF00421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D7PFV0 | 1-62 | MTIAFQSAVFALIAISFLPVIGVPVALASPDGWSSSKNVVFSGVSLWIGLVLFVGILNSFIS |
| A0A6M5U9X3 | 1-76 | MVEIHLLVAWRIKSMTLAFQLAVFALIATSSILLISVPVVFASPDGWSSNKNVIFSGTSLWIGLVFLVGILNSLIS |
| A0A7J6ENX8 | 148-220 | None |
| A0A481WCK0 | 1-60 | None |
| A0A7G7YG33 | 38-110 | None |
| A0A0H5B0D5 | 1-60 | None |
| A0A3Q7IWM2 | 1-60 | None |
| A0A5B6UGK9 | 110-182 | None |
| A0A3B6MJD8 | 1-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.