DPCstruct | MC27451
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 361 ± 63 aa |
| Standard deviation of domain lengths | 63.49 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 25.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7QRH3 | 29-411 | DAAGNGKNVFFVHGYNVTSSSGRGWNAEMFKRLHWAGSRTRYWAVHWEGDLGWPNAFNYHRNVANALAIASNLAAVINSIPGDKTVL… |
| A0A143B9L6 | 26-468 | NDDNDFIHVHGYNVNDQDARGEQAEAFKRLYWSGSRARFWGITWYGWDTQLSVPIPGIGTRTPNYHINVRRAFETGRLLKDFVSTAG… |
| A0A4Q1C894 | 817-1208 | None |
| A0A7X6V3K7 | 2-282 | None |
| A0A388PA11 | 1-269 | None |
| A0A7X9AAA8 | 156-557 | None |
| A0A7V6HGA2 | 209-575 | None |
| A0A7V6HEH8 | 486-891 | None |
| A0A7V6HE61 | 84-468 | None |
| A0A7X6V8V7 | 44-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.