DPCstruct | MC2745
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 114 ± 9 aa |
| Standard deviation of domain lengths | 8.84 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 43.12 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF18578- CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9RMF6 | 25-140 | QLEILRERRGLWYEYASLIPILVRSGYTPSMIEEETGMTGVEQNIIVVGSQVRNSLKANGFDEEMLRTFDLGGGELLYELRILSAQQ… |
| A0A5N5HMS0 | 60-156 | ANGRLEILANSLGLWFEYAPLIPSLTQEGFTPLTIEEITSISSVEQNRLVVAAKVNDSLVQSNTDLEIVSEFDLGGFKLLYEIRLLS… |
| A0A250X2D9 | 139-260 | None |
| A0A0D3HE66 | 102-220 | None |
| A0A7J7QED6 | 132-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.