DPCstruct | MC27447
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 223 ± 29 aa |
| Standard deviation of domain lengths | 28.58 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08702 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J2VKR7 | 2-179 | RLRKICARTQQYISETTSNMLTTAKVYKAHRKIIVQTHVSELRYVDVAEALHRNLTLLRKRSGELSQKLKELQHLILEQIKEMHRTE… |
| A0A553Q4P9 | 10-193 | QKAPKYYGYSRSGQCPVQPTYPLCSDEETVDKCPSGCLLEGSMNVLEEGIHRRLRKICDRIQQNLDGCSSVMLKSVEFYRSQRKTIV… |
| A0A3P8XRN5 | 277-522 | None |
| A0A1L8HLL9 | 3-204 | None |
| A0A7J5ZW40 | 10-264 | None |
| S4RTG4 | 5-232 | None |
| A0A6G0HKE1 | 61-300 | None |
| A0A401RMN4 | 10-263 | None |
| A0A0F8AIR2 | 12-204 | None |
| A0A6P3W3K7 | 17-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.