DPCstruct | MC27444
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 432 ± 80 aa |
| Standard deviation of domain lengths | 79.95 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 18.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0529 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D3VDI9 | 41-489 | EGPYSRLKTSVFNSTDDSIIPKTGLSILERILLTSFGVTSVKFYGYQSEMLWSFPSAGACYPVEAYVIVRSLDGVEPGVYHYSALNT… |
| F6I395 | 18-579 | NEAQVLKYHNQTKHSFTNYARGPRGLDWANQPKPFRRFDSAPLVPLLHPPPPNQTPPPYSSVFLNLPPPKPISKSTISQLFFDSLAI… |
| A0A7G7YPZ9 | 73-377 | None |
| A0A7V4CHB7 | 7-391 | None |
| A0A3N6G0E0 | 2-312 | None |
| A0A096BJ77 | 18-411 | None |
| Q3EUC7 | 2-405 | None |
| A0A7V5FQ99 | 15-336 | None |
| D7KP50 | 292-865 | None |
| V5BJN1 | 156-664 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.