DPCstruct | MC27440
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 89 ± 7 aa |
| Standard deviation of domain lengths | 6.54 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 29.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A127VYY4 | 1-88 | MKNVEVLVRVKELKTKRADELELDAYWVLKRLKDISDRSMQAEPVMMFDPASGGMAESGEYEFDSTGANKATELIGKHIGMFYPKLQL |
| A0A1H1GDA7 | 10-87 | ERGERESVATKKAAKAHSIDRLWVLARLVDNVNRAMQGKKVTARGAPTGEYRYDGSVANRALELIGKELGMFVERNEN |
| A0A1G0I5Z3 | 70-164 | None |
| N6W9I6 | 64-150 | None |
| A0A2E0Z4L4 | 82-162 | None |
| A0A7W1KPQ4 | 56-148 | None |
| A0A7S6S5J3 | 31-118 | None |
| R5AT05 | 69-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.