DPCstruct | MC27438
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 96 ± 12 aa |
| Standard deviation of domain lengths | 11.68 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20629 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N6XJ47 | 1-97 | IYAATPASEFVCGTQQVASGITVQVFTTGRGTPYGLMAVPVIKMATRTELANRWFDLMDINAGTIATGEETIEDVGLKLFEFILDVA… |
| A0A327YEP6 | 2-87 | PMVNRNGTVGFVYVGSPGYDQGAVTGQAASGATLTVVSTGCGSCFGARPAPRNKLASNSDLARRGPEAIDIDRGVVIEQDVSLSLT |
| A0A832BDT2 | 238-329 | None |
| A0A7C7VQG5 | 112-194 | None |
| A0A4Q4XJE0 | 407-502 | None |
| A0A0A3YKL5 | 1-86 | None |
| A2WIZ4 | 710-802 | None |
| R5PMS8 | 91-198 | None |
| A0A1V1X022 | 76-188 | None |
| A0A545SNI8 | 18-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.