DPCstruct | MC27437
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 94 ± 14 aa |
| Standard deviation of domain lengths | 14.30 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0497 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378A552 | 41-132 | QLTEADIRLWTTLVRFDPVYVTHFKCDKRRISDYLNLYGFLRDIYQMPGIAETVSFPHIRHHYYRSHKTINPTGIISIGPQQDLNEP… |
| A0A327Y471 | 10-93 | WPTLARFDAVYHGHFKCARRRLIDYPNLWGYARDIMTWKGVAETFDEAVIRAAYYGEDRDLNPFGIVEMAPALDWTAPHDRGRL |
| A0A0F6QZA0 | 14-109 | None |
| A0A820XGV0 | 912-1004 | None |
| G6FVT3 | 2-84 | None |
| A0A3N4IUP0 | 28-110 | None |
| A0A2J8AGS3 | 464-564 | None |
| A0A6S7GPJ1 | 219-318 | None |
| A0A329RZB0 | 2-86 | None |
| A0A814S665 | 33-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.