DPCstruct | MC27436
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 62 ± 4 aa |
| Standard deviation of domain lengths | 4.22 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 50.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X2XIA9 | 51-106 | VRGLMNVQFAVKDNEVYLIEVNPRAARTVPFVSKATGLPLAKVAARVMAGKSLTEQ |
| A0A1M5K8K8 | 2-62 | FCGLMNMQYAIEDDKVFVLEANPRASRTVPLVSKVCNTQMARLATRLMMGEKLEDLKLKDK |
| A0A5D6Y2C1 | 498-557 | None |
| A0A2C9JPL3 | 229-282 | None |
| A0A6L5DAJ4 | 303-367 | None |
| A0A6L5DB46 | 86-157 | None |
| A0A1V5KA10 | 489-548 | None |
| A0A538IYV9 | 157-214 | None |
| A0A7C6KGR3 | 73-131 | None |
| A0A377CGA7 | 10-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.