DPCstruct | MC27435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 220 |
|---|---|
| Mean domain length (aa) | 164 ± 32 aa |
| Standard deviation of domain lengths | 32.26 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0498 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3ZD25 | 14-141 | VEIPIFVSKYASKLKTEPNEAFFWSGRTDGIGGQYIALEIALSRKGITLEGLIEKNKIPMPIWEERPDVWEAISEKYAQQVSGEIRA… |
| A0A6A5Z3B6 | 22-192 | AHPVEVLDDLPPPPQRRYQACEPIGTYTTDWFLSTPLPDYHGIFNNTALFYTRGLTSRAISHATAHGLTTIWAVWPCYLYNHLNTTD… |
| A0A7M5UYU5 | 29-206 | None |
| A0A3E2YT12 | 98-244 | None |
| A0A2G8LBS8 | 2-182 | None |
| A0A6A5X5E6 | 54-288 | None |
| A0A0D0EYW7 | 112-211 | None |
| A0A545VHW6 | 34-216 | None |
| A0A0M2HS29 | 594-736 | None |
| A0A179IG66 | 16-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.