DPCstruct | MC27433
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 114 ± 10 aa |
| Standard deviation of domain lengths | 10.29 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5WX56 | 6-112 | AALNVFYYFQKQELKLSFNTPHQAALYQNLNREARIFASEPTATFLPLSPSMSYLRDSSKGLVIGFSRTEDADRWRQSSILGQKHGP… |
| A0A6A5YZK5 | 1-114 | MPNDTTSHDSIIGVGYSFRDREIHFHFDSHDKAKAYQRKNYEARIPKDHPKHVQIPVADGIKYLRDSDHGLVFGFSTIDQAKAWGQH… |
| A0A317WS66 | 6-114 | None |
| L7IR44 | 74-190 | None |
| A0A084RXL6 | 1-116 | None |
| A0A4Z0Y6A4 | 1-147 | None |
| A0A6A6RR98 | 51-163 | None |
| A0A318Z4Z1 | 2-107 | None |
| A0A317VPN6 | 1-114 | None |
| A0A4P7NPR5 | 76-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.