DPCstruct | MC2743
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 116 ± 9 aa |
| Standard deviation of domain lengths | 8.51 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11210 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7N0UHV9 | 69-182 | KPKAAEVPLHQLMEEEVIPALRSTLEAQKDITNIELSFHDNTLEGSFQQKGTPYSFWAFFPDGNLTGPKGFSISSFGAKASTVEPFI… |
| A0A2N5JMR9 | 9-112 | FTNFIEQELIPALQKALNDRGITDIVLTYQDLKLKGSWRNNQRQFILFFAKEDINAQKAFACSDGKTEPGTIEPFLGDERKIGIELI… |
| A9TPM4 | 1-103 | None |
| A0A164Z5C9 | 331-443 | None |
| A2BWG7 | 197-319 | None |
| A0A164AZV3 | 259-381 | None |
| A0A830D7H0 | 537-649 | None |
| K9TRJ1 | 103-232 | None |
| Q6YSF1 | 1-104 | None |
| A8G4Z0 | 236-360 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.