DPCstruct | MC27423
Metacluster Properties and Pfam Annotations
| Number of structural domains | 830 |
|---|---|
| Mean domain length (aa) | 161 ± 27 aa |
| Standard deviation of domain lengths | 26.66 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 14.04 |
| Pfam Score | 99.77 |
| Assigned Pfam label(s) | CL0526- CL0177 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T4TUN2 | 2-164 | QNTLATLDQHLSQLRPELYANLNAPLTEDAIAALEKSYGIALPADVKTLYQWKNGQRDDYYEAFVNNSTFLPLQEALEIAKELTGMI… |
| A0A7Y2DA36 | 4-188 | VRSLWNRLENWGRTNAPKMLEDLNSGAGDDEIIALESALNLTLPASYKESLRIHNGESDGWPCKIFADRGAYLSTEGVLKEWNMRRE… |
| A0A1W1WZT3 | 15-219 | None |
| K7FIQ1 | 2-154 | None |
| A0A7H9BQV1 | 190-358 | None |
| A0A348Y0T0 | 3-135 | None |
| A0A2Z5J6C2 | 398-560 | None |
| A0A1H6MTI4 | 1-178 | None |
| A0A1W1X8S3 | 7-151 | None |
| A0A1G7BLS1 | 8-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.