DPCstruct | MC27421
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 78 ± 7 aa |
| Standard deviation of domain lengths | 7.09 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 49.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0369 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L9U7E7 | 17-91 | KAFVSEYALTGEQAKYGTLLGAVSEAGFLIGLERNSDHVMMASYAPLFVNANDRQWNPDAIVFNSHEVYGTPSYW |
| A0A413BGJ6 | 229-303 | IAVFAGEYAAHTTDRQNNMESALAEAALLTGIEKNADVVKLASYAPLFNRVGHSQWKPDMIWFDDEKVYLTPNYY |
| A0A4U6V0U0 | 1-77 | None |
| A0A287L294 | 35-114 | None |
| A0A818B5J3 | 27-118 | None |
| A0A453HQN7 | 112-186 | None |
| A0A1R3NDP5 | 17-91 | None |
| A0A4S8L2C6 | 35-119 | None |
| A0A0E0J675 | 4-79 | None |
| A0A2J6KZY5 | 193-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.