DPCstruct | MC2742
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 204 ± 26 aa |
| Standard deviation of domain lengths | 25.75 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N5JMD5 | 10-212 | EDLGAGRTTFEQYEDVFKTDQEAAEALRKFCKLFSASYAPLFSFRSSLFEVLDIQDTKGFLLDLSSETVIDPIHLLRYYEFASDGQS… |
| A0A6P0RFQ4 | 1-180 | MQCGIYDLTETNNLDRFKTYELPGILSNLEIESMTKKDFLRLLDETMEKTGEAIAKGRFEYCLAFMKLRSYREQRLDWKFTYRGKLE… |
| A0A0E3RIA7 | 187-363 | None |
| A0A535QS10 | 286-491 | None |
| A0A2R6ANG8 | 13-218 | None |
| A0A7T3K4A7 | 193-409 | None |
| A0A0D6ASX0 | 7-175 | None |
| A0A5P8WGQ5 | 82-271 | None |
| A0A2N6KNJ7 | 33-241 | None |
| A0A3D0CU40 | 677-856 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.