DPCstruct | MC27419
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 186 ± 31 aa |
| Standard deviation of domain lengths | 31.15 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.20 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF21070- CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485BQ87 | 29-223 | EFIRKDSGRIDRFLTTELNGVLHKEGSQWVPDTAHSQGLTFNPAFLRAVNQLSQLSDILFTDGSQGISFELQARPASQVVETRLTID… |
| A0A7W1GFI4 | 240-426 | QFLNPQDGDLTKFLNGRLRSYFEEDWSVKKEHTEKFAPEFVNYLKNARRLRDALFPGGSGRQPNVEYKLMIASPLREAMVKIEIDGT… |
| A0A2N7YYS6 | 1-160 | None |
| A0A7Y2UTP4 | 207-393 | None |
| A0A2R7PU62 | 25-180 | None |
| A0A3M5UBL3 | 23-201 | None |
| A0A2X3JEX2 | 8-160 | None |
| A0A661KXF3 | 384-580 | None |
| A0A1I3NGR2 | 690-866 | None |
| A0A2D8A8U2 | 247-443 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.