DPCstruct | MC27411
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 131 ± 21 aa |
| Standard deviation of domain lengths | 20.56 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 18.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A857HI93 | 1-127 | MLNEKKIKAIGLIAEGNLTMTEIAKEVGVSRNALYLWRKDKEYQQELDKEIQNFKLLAQQERNARAKNWFKKLEYIAMDDDQKTKDQ… |
| A0A417P7M9 | 1-120 | MRITDEKMIGALVTTGNITKCAEMLGCTRKSIYDRLQKPEFYARLQQQRKDSFALATSKVTNAQEMAVQTLIDIMNSADASDGCRIK… |
| A0A0D6AP08 | 82-180 | None |
| A0A2E9Q9X9 | 35-197 | None |
| A0A7Y5VNI0 | 44-183 | None |
| A0A0F9HG09 | 40-174 | None |
| A0A1Z9WHD1 | 8-110 | None |
| A0A3M1CFP5 | 19-183 | None |
| A0A6M0G4W5 | 1-131 | None |
| A0A162L450 | 19-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.