DPCstruct | MC2741
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 155 ± 19 aa |
| Standard deviation of domain lengths | 19.00 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04208 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G1QSR7 | 32-180 | LKVRDPVNHVGICTLWTEREIVEKILDKLPYNVIGNLYSAQGINAMIRNVMANPNIRTIVLWGSEMSLSGHSLLMLMKYGVDEKRKI… |
| A0A7C2TPP3 | 2-135 | AYFGNKNSSVAVCTLSSIDLLKKLSEPKFLQNVAMIGRLLSENKGIESLVHYVNKNPNIKTIILCGKEVWGHKAGHSLLQLHKNGVD… |
| A0A3A4VH64 | 38-194 | None |
| Q12TW9 | 1-143 | None |
| A0A521S0W3 | 29-201 | None |
| A0A523AYC1 | 82-260 | None |
| A0A496RH28 | 6-147 | None |
| A0A3M1GVG7 | 104-269 | None |
| A0A7C1FHS0 | 2-122 | None |
| A0A135VGZ9 | 4-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.