DPCstruct | MC27409
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 130 ± 14 aa |
| Standard deviation of domain lengths | 13.73 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05232 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5FEJ1 | 4-146 | KPKLRTFPDRLRQIAMFEIGGLVLITPPFAWASGVPIRDSIGLLALLALMAAIWNGAYNTAFDWIEGRLTGRTADRRPFRLRAVHAL… |
| A0A6F8PML5 | 4-134 | LSPIKRRLTYVVLFEITAIIFSTLVLMLLSESDAQESLPVAIFISLAAGIWNYLFNTAFEFWEMRQQIQERTFAIRSLHALGFEGGL… |
| A0A2G6LJU8 | 2-123 | None |
| A0A2E2ICK1 | 2-139 | None |
| A0A542Y9B4 | 48-178 | None |
| A0A829KGS1 | 37-171 | None |
| A0A2A2KAG9 | 6-139 | None |
| A0A6I4KU85 | 5-130 | None |
| A0A4Y8WY54 | 83-224 | None |
| A0A7H9UV14 | 2-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.