DPCstruct | MC27408
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 158 ± 31 aa |
| Standard deviation of domain lengths | 30.92 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05661 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1W8Z7 | 17-183 | VTGAIRTDFILSAEIMALTLAGVSTSNIATQVAVLAAVGILITVAVYGVVAFIVKADDIGLHLVSTGRGIGKAIGNGLVKGVPVFLQ… |
| A0A7C1ZQ03 | 18-179 | IKGAIRTDFVLSAEIIVIALGVVQGEPFTTQAIVVSLIAILITVCVYGLVAAIVKFDDLGLALIRHGEGESGFDRFQRGLGQIILFL… |
| A0A378N7N3 | 26-196 | None |
| A0A6G3VNB2 | 64-233 | None |
| A0A7Y2QYE4 | 35-207 | None |
| A0A6L4A7E8 | 1-114 | None |
| A0A1W1CKN7 | 98-287 | None |
| A0A090RV17 | 4-146 | None |
| A0A0G4BZG0 | 2-125 | None |
| A0A6N8FDV4 | 99-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.