DPCstruct | MC27400
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 190 ± 32 aa |
| Standard deviation of domain lengths | 31.71 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 90.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379VM71 | 1-132 | MTVADIRNNPVIAYEEDCVTRLIQDDVNETAYNRIKNWSISELREYVLSDETSVDDIAFTRKGLTSEVVAAVAKICSNADLIYGGKK… |
| N8NTQ3 | 3-217 | YQINVASQHYVFEDLKTLLAKATPERSGDQLAGIVATDATERVAAQMCLAEVPLQQFLQEAVVPYEEDEITRLIMDEHDADVFYPIS… |
| A0A0L0SU69 | 39-247 | None |
| A0A350T2D4 | 1-217 | None |
| A0A377Z8A0 | 2-198 | None |
| A0A6N3R6B3 | 2-134 | None |
| A0A447W771 | 178-308 | None |
| A0A2X3DG51 | 3-197 | None |
| A0A5C9BTB2 | 246-460 | None |
| A0A133Z343 | 1-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.