DPCstruct | MC2740
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 311 ± 36 aa |
| Standard deviation of domain lengths | 36.48 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D4ACM6 | 1-254 | MGEARRRLERVRRRRLRLRERARERETEREAEAAQATEREQEIDRWRMKCVQEVEEKKREQELKAAADGVLAEVRKKQSDTKRMVDI… |
| A0A7R8V4J3 | 4-299 | KNRTALQIFRGFPPHLARHDIMQLLNNINFLESTEKELKECMNTLSESDWDAKLREINSVKDEVSKILQSYDDKLGVATLQKILCKR… |
| A0A1B6GP71 | 125-485 | None |
| A0A1Y1WYB0 | 20-321 | None |
| A0A182IW74 | 61-396 | None |
| A0A7J5X8I6 | 156-492 | None |
| A0A182SJV7 | 107-414 | None |
| A0A397UC81 | 2-281 | None |
| A0A822HZW7 | 22-393 | None |
| H9JCG1 | 34-377 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.