DPCstruct | MC274
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 224 ± 18 aa |
| Standard deviation of domain lengths | 18.43 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 94.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5J2U7 | 24-274 | EGWGVIVDQWGGYDVSGMSGSTIHNGGYGFCMNTFDLAWPLTAMLRYDQRYARAVGRWALNAANTARLFYPNDIPDGLQALPNRKAL… |
| A0A645GZD5 | 1-220 | MNSMKMAWPLVPMVKYEPRLARAIGKWMLNNINASRLFFPNEIDDKHQWLPEMKDYTKSIVAYEGLRFEDCYNKPELKGVHPVALGD… |
| A0A097EP47 | 367-611 | None |
| A0A3M2HZ19 | 151-392 | None |
| A0A660XN17 | 1-214 | None |
| A6DPF0 | 685-924 | None |
| E7G6G2 | 80-320 | None |
| A0A7K0HEV2 | 33-257 | None |
| A0A1I0V8X6 | 333-543 | None |
| A0A7W0XGM8 | 210-418 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.