DPCstruct | MC27397
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 125 ± 5 aa |
| Standard deviation of domain lengths | 4.79 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 77.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 30.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E7QFG5 | 1-124 | MKISLKIYISALAAAFFLLGSQFNTAEAAKYGPLPKVDWWGKSHSKVIKTVNKKYRGNRKSYISRWNKYRTRMERLHEAGSAAVVKS… |
| A0A1G3IB87 | 178-293 | AIPNPEQGDLSAPTPKTTSGECPKVPDIVWWENKTHEQAIRYVTNNYNGDWKPYIVKWESHLNKVVDVFVSGKKAMIKTTGKVLGEN… |
| A0A7C1UIU9 | 6-138 | None |
| A0A7V7FKM6 | 174-298 | None |
| A0A2D8QJC3 | 3-127 | None |
| A0A2D6JT58 | 149-270 | None |
| A0A7V7FMJ6 | 1-124 | None |
| A0A2D6G639 | 108-239 | None |
| A0A2D6FZV2 | 14-135 | None |
| A0A2D6JSR5 | 1-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.