DPCstruct | MC27396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 89 ± 15 aa |
| Standard deviation of domain lengths | 15.45 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0509 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T2NSF4 | 4-87 | RRTKRKKFEEKVVDPHTSVFTINKEDHTLGNLLQQCLCLMKCVKFAGYNVLNPLESTIKLRIGTDGSVTPKDVLVACMRKTIED |
| A0A7R9LE94 | 13-85 | FDGEKKIMIEKDTKVPNAAIFTVQKEDHTVGNMIRMQLLKDPQVLFAGYKVPHPLTHEFVLRVQTTPDYSPQE |
| A0A0F7SWW8 | 26-121 | None |
| A0A7S3ZM41 | 96-196 | None |
| A0A4Y7MVH2 | 51-151 | None |
| A0A835HER4 | 1-62 | None |
| A0A835H1F3 | 2-62 | None |
| A0A843CF04 | 2-88 | None |
| A0A2I3TF89 | 1-93 | None |
| A0A0M3QVR6 | 2-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.