DPCstruct | MC27392
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 224 ± 19 aa |
| Standard deviation of domain lengths | 18.60 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 68.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 25.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5ZCX0 | 275-498 | NIWAAPDQSPPHEPSWLDFSQFNVNPYLPGIFSGGMRERLGSLEITLSPTASGHPLLKEQSILSPLLEPLLSTYITQPPCRTIGLFT… |
| A0A2T2N5Z6 | 1-218 | MEPDPLLPVIPRWIEFSQFQVNPYFAWLFSGRITCTVSGYEISLLPAAFFSNQMIVPSAFSGQIIDLIKSQFLTYPPCKRLAIKYWG… |
| A0A6A6ZLK5 | 162-373 | None |
| A0A6A5ZY61 | 182-408 | None |
| A0A6A5ZDE5 | 1-241 | None |
| A0A317B838 | 35-269 | None |
| A0A6A5YLK3 | 88-348 | None |
| A0A7C8IIA7 | 90-285 | None |
| A0A6A6TCD8 | 138-342 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.