DPCstruct | MC2739
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 590 ± 89 aa |
| Standard deviation of domain lengths | 88.87 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.35 |
| Pfam Score | 88.89 |
| Assigned Pfam label(s) | PF01722- CL0028- PF14932 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L7LHY6 | 164-731 | ARISKRSLRHLYFLHLQKGNFLTANRTQYNYFQMKQLAKKMDFSKKTVLFMAGYLDSSDLLSIAPAMGGLYTRKGYNMLAELAGQGL… |
| E9IXI6 | 1-616 | VYPTLIASFASNPNYTLFADERKTTYIIDISEHELTPTDYEELAQTALKTSFLLYTRYNPKIGQPLFIDDKDSIKKSFWNPAHPTRI… |
| A0A139WB15 | 1-647 | None |
| E4YD67 | 9-519 | None |
| A0A195CVK2 | 3-519 | None |
| A0A5E4QET8 | 2-426 | None |
| A0A7I8VRE5 | 39-687 | None |
| A0A1I8G2R3 | 12-750 | None |
| A0A2A4JPF3 | 7-513 | None |
| W5J8G6 | 1-626 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.