DPCstruct | MC27388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 385 ± 45 aa |
| Standard deviation of domain lengths | 44.52 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A518DXS7 | 292-652 | ATPEPAKPEPKPTPPKAPPKPPNPFRSLKPAVDLVASAADGKVDLGQVLLNKDEVLFVRLYGGDHAAGNEPVKFEMVDVAGETHTWQ… |
| A0A1G2ZRW4 | 76-428 | PDSQPPSQRGPETEPQSKPEVRKVTEETGDPFRELKPAVNLPALPGTDPSQAGPSDSISLGSLHVPEDGSAKITLEGGKDAVKGSRE… |
| A0A517Y9B1 | 37-375 | None |
| A0A5Q4H3G1 | 299-651 | None |
| A0A3L7N2W0 | 175-678 | None |
| A0A3L7VQ33 | 2-407 | None |
| A0A6I6AI80 | 416-854 | None |
| A0A5C6D0P5 | 99-495 | None |
| M5UN19 | 280-653 | None |
| A0A518E0I8 | 719-1065 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.