DPCstruct | MC27386
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 126 ± 11 aa |
| Standard deviation of domain lengths | 10.52 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G2ZHK1 | 1-133 | MDEQEAEACKSQPDTSTEPDSTHPPARKSKRSTESGEARIKLIAALTKHHGYADGSSLNLEPIGNNELARLAEVAKRTASAFFKKEF… |
| A0A3D2U542 | 196-308 | NKKSTNKGDAQTKIIGALSAHHQFDGGECLNLEPIGSNELARLAEVSKSSASLFFQKQFAAEHPTSGEGRRKYREACRSSYKLSLEI… |
| A0A5C6AAW5 | 360-481 | None |
| A0A5C6CUZ8 | 136-264 | None |
| A0A838QU46 | 224-333 | None |
| A0A517NAS4 | 294-421 | None |
| A0A2E0WZ82 | 553-697 | None |
| A0A3A0DT76 | 638-758 | None |
| A0A6M5YVJ7 | 410-548 | None |
| A0A517MJ69 | 67-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.