DPCstruct | MC27384
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 217 ± 41 aa |
| Standard deviation of domain lengths | 41.19 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.38 |
| Pfam Score | 97.62 |
| Assigned Pfam label(s) | CL0069- CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A503XLF8 | 12-217 | LINVTGKLGGSINGVATNGTVTGSADRSTGHVTNVYHGIDRAIGPELSVMHQGLTIVCAHMAVEAGAAKNLNSMAPMQTLQRLVTFT… |
| A0A6P8IL80 | 4-154 | LVKKDMCIKMTMEGTVNGHHFKCVGEGKGKPFEGTQVEKIRITEGGPLPFAYDILAPCCMYGSKTFIKHVSGIPDYFKDSLPEGFTW… |
| A0A0R3QYN7 | 1-157 | None |
| W6U5W5 | 61-315 | None |
| A0A1B6CU47 | 98-312 | None |
| A0A6J8AQL3 | 17-232 | None |
| A0A4W5KER7 | 175-331 | None |
| I1YZZ9 | 43-261 | None |
| A0A6A5FQK5 | 473-702 | None |
| A0A1C3GHU4 | 15-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.