DPCstruct | MC27382
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 84 ± 9 aa |
| Standard deviation of domain lengths | 8.73 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.60 |
| Pfam Score | 87.64 |
| Assigned Pfam label(s) | PF02666- PF12588 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3CAV5 | 11-90 | SPDSRKTLGEEEGGWFSQPAMRSMEQYYDEYFDQIFVCEPQAPHKGFTSWDHFFNRIFRKGICPPPLQGAGKLNTACEST |
| A0A7C4T8Q2 | 126-212 | LKTWGEFLNSEKSLYVLNDSPDGWKSKEAQEFLKMDDYIYDPNDPYWGYKSWNDFFARKVKPSTRPIAQPDNDKIIVSPCDTTIFNI |
| A0A0P7BEB7 | 752-829 | None |
| A0A0D0UAC8 | 153-230 | None |
| A0A146INV2 | 140-211 | None |
| A0A7M5X899 | 144-239 | None |
| E4ZUI4 | 238-335 | None |
| A0A7M6DRM9 | 176-259 | None |
| A0A7D9EDQ3 | 83-176 | None |
| A0A517LJM0 | 216-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.