DPCstruct | MC2738
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 207 ± 27 aa |
| Standard deviation of domain lengths | 26.72 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A443QUY4 | 144-365 | NKSCEVSIEQADKCALKLMFEGDRERVVPRSLDDMEAHCRNATTKIKCIEKHAKCYSSFPRQVMGTALSNIKRAYKQRCSREGKKEF… |
| A0A7R8UZJ3 | 16-225 | SIIVCYVSSEDCGQEELTNCARPLQILQSTSELSIAAKKEELEKLCPDLHNGLHCIRSYTRRCMTLQQRNQFNKMYHGTNQVIRDLC… |
| R7TFX5 | 155-322 | None |
| A0A0M3HRZ1 | 27-244 | None |
| R7T481 | 36-260 | None |
| A0A6L5CFJ0 | 18-173 | None |
| A0A1Y3BKJ6 | 9-220 | None |
| A0A2T7PCH1 | 120-316 | None |
| A0A3S3PAI7 | 190-409 | None |
| B0WWF6 | 2-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.