DPCstruct | MC27377
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 97 ± 8 aa |
| Standard deviation of domain lengths | 7.61 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 38.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N7D169 | 253-353 | IPTYNTLRHASSTYALVEAWELTGGDALRQAIETSLAYLAGSLIRHYTLPDGRRAAFLVDTGEEIKLGGNAVCLLAFVKYSEVTGSR… |
| A0A0C1S0Z5 | 1-90 | MLGHAGTIYDMADLYRLTKDKILLEKTQKAISFLLKNLKNTQVNGQNVLVALDNDNIKLGGNALAILALTEYMEVTDTREYLETAQK… |
| A0A4R6FYC9 | 248-338 | None |
| A0A378BE15 | 83-189 | None |
| A0A1H9TWS3 | 41-132 | None |
| A0A562R040 | 292-382 | None |
| A0A3D5VI03 | 242-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.