DPCstruct | MC27376
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 94 ± 15 aa |
| Standard deviation of domain lengths | 14.78 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 23.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C1RNC3 | 3-86 | GQQFLPAFPEGAVRIGKSSLSLLTKDGTVNYFIGADNYHSHKESDTASRRYILASLMEHKHVRPRDLEGPPLCIPHRTLMNWTS |
| A0A7Y3URT8 | 1-77 | MQTLLPIFPTESTRINEVLSFEKREGTVWYFHGCMPVFSHNEKDNASFNMYTSQLVVLGQCRQVEIVKAFGVSPISV |
| A0A661J1B8 | 2-95 | None |
| A0A836WTJ3 | 13-113 | None |
| A0A3B0YXM2 | 2-68 | None |
| A0A1V1P3B8 | 96-202 | None |
| A0A661QF64 | 1-95 | None |
| A0A848A890 | 4-99 | None |
| A0A7W0QAX8 | 37-156 | None |
| A0A7X5U5H6 | 3-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.