DPCstruct | MC2737
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 165 ± 23 aa |
| Standard deviation of domain lengths | 22.84 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10558 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8UW93 | 5-154 | AGDYDLFRDSWLRFLGYANEVGEAFRPLIPRSIVRLSYGVAIGYVLADVGSKTKETYEGNKKVKNAAITALDVFLWQLFASVIIPGF… |
| A0A0M3KHA4 | 1-136 | YANEVGESFRALIPVNFVRLSYVVSFGYVCADTADKSRKSLRLKYASEEERCKAVGLTAIDTLLWQSFASVIVPGFTINRLCALTAK… |
| A0A7S2BQS7 | 162-313 | None |
| A0A7S4AHR1 | 54-241 | None |
| D0NY49 | 5-155 | None |
| A0A7S0DSR4 | 132-309 | None |
| A0A7J6RQD1 | 34-208 | None |
| A0A5N6X540 | 5-194 | None |
| A0A5J5CZ02 | 6-162 | None |
| A0A099P755 | 292-463 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.