DPCstruct | MC27369
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 117 ± 14 aa |
| Standard deviation of domain lengths | 13.63 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4ITI7 | 69-167 | GSSGKATVNKTQAIKQYLATHKGAKPAQVVEALRKQGIEVKAGYVANIKTKSKRRRKAVKQVIETTGIGLPEIKAAISLLKLTNGEA… |
| A0A518E298 | 1-115 | MAKRKSKSGVNKTAAVKSEFAKNPEARPKEVVAALAEQGVVVTTGYVSTIKSAMKRGDDGAAAPVAGFRKRKAVAGKTVSSTGISLV… |
| A0A7C4QR84 | 1-100 | None |
| A0A847GKY9 | 74-189 | None |
| A0A517N8G7 | 48-167 | None |
| A0A7V4HPM5 | 1-140 | None |
| A0A5C6AGL5 | 1-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.