DPCstruct | MC27365
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 204 ± 14 aa |
| Standard deviation of domain lengths | 13.61 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 23.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X4YHW2 | 13-202 | NKDFKIDWEYTISFDGFKKYIDENGIKKYQLILDKEGNKNEDSKTLVAARKMNIKNVIEDDSQNHIGIQIADMLAGIISKFIKMLEE… |
| A0A414XGU9 | 1-223 | MIDESFVSFNTKNYYSWDYELETDLILNKIENDTRNNYSFIFDEGTKASKILKSKLDKQNVQVIESDSKKDTMIRFVDWMATFFGKL… |
| R8DMD4 | 122-332 | None |
| A0A806T6Z1 | 49-241 | None |
| A0A2Z4VW94 | 80-287 | None |
| A0A645DQL5 | 102-300 | None |
| I0SMX3 | 439-649 | None |
| A0A7C7AF13 | 71-249 | None |
| A0A1N6GN34 | 1-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.