DPCstruct | MC27364
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 114 ± 16 aa |
| Standard deviation of domain lengths | 16.48 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 18.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z1CMZ2 | 6-115 | PGDRLSADMLRLIAHVTSPLAETSSKLLGQAEGATVVRYSATMLDVEVPSDIPAVDLPDGPAPGSALVYEREQLVGELLVWIRDGRL… |
| A0A543NP72 | 3-130 | TRALTPAVREVVLGILQATDTADARVLLGQLMVAQESFFDDGVEGFSTTVEFQVSDDVVRVVPHHQTYPVRADYQAPDGTLLQISLQ… |
| A0A7T9IIP5 | 4-112 | None |
| A0A7W3FQU5 | 4-111 | None |
| A0A1R4HVJ1 | 7-149 | None |
| A0A1S2Q735 | 1-117 | None |
| A0A2M9D324 | 154-259 | None |
| A0A7G6Z119 | 5-108 | None |
| A0A2S8VRV4 | 84-199 | None |
| A0A2L1S790 | 81-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.